132458-PE
Grade
Affinity PurifiedConjugate
PESpecificity
Recognizes human RECQL.Applications
FLISA WBAccession Number
NM_032941, NP_116559EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeBSA Free
YesPreservative Free
YesNotes
Preservative Free
BSA Free
RECQL (ATP-dependent DNA Helicase Q1, DNA Helicase, RecQ-like Type 1, RecQ1, DNA-dependent ATPase Q1, RecQ Protein-like 1, RECQ1, RECQL1) (PE)
DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
