132458
Grade
Affinity PurifiedSpecificity
Recognizes human RECQL.Applications
E WBAccession Number
NM_032941, NP_116559EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CRECQL (ATP-dependent DNA Helicase Q1, DNA Helicase, RecQ-like Type 1, RecQ1, DNA-dependent ATPase Q1, RecQ Protein-like 1, RECQ1, RECQL1)
DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
