133211-ML550
Grade
Affinity PurifiedConjugate
MaxLight™550Specificity
Recognizes human SETDB2.Applications
FLISA WBAccession Number
NM_031915, NP_114121.1EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezePreservative Free
YesNotes
Preservative Free
SETDB2 (SET Domain Bifurcated 2, Histone-lysine N-methyltransferase SETDB2, C13orf4, Chronic Lymphocytic Leukemia Deletion Region Gene 8 Protein, CLLD8, CLLL8, Lysine N-methyltransferase 1F, KMT1F) (MaxLight 550)
EC=2.1.1.43
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.