207670-FITC
Grade
PurifiedConjugate
FITCSpecificity
Recognizes human GRK4.Gene ID
2868Gene #
GRK4Applications
FLISA WBAccession Number
NP_892027EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CBSA Free
YesPreservative Free
YesNotes
Preservative Free
BSA Free
GRK4 (G Protein-coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (FITC)
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.