Cerato-ulmin, Recombinant, Ophiostoma Ulmi, aa26-100, His-Tag (CU, Dutch Elm Disease Toxin)
Dutch elm disease toxin
Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.
Source
Recombinant protein corresponding to aa26-100 from ophiostoma ulmi Cerato-ulmin, fused to His-Tag at N-terminal, expressed in Yeast.
Amino Acid Sequence
SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Form
Supplied as a liquid in Tris, 50% glycerol.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
