Recombinant protein corresponding to aa710-1320 from Nosema bombycis PTP3, fused to GST-Tag at N-terminal, expressed in E. coli.

~93.7kD

DEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGMKRLSHIDPNKNVAISETPTDDNKESIYSAFKNVSPNEAVGKFIEDTFNSAYSSGQAQRFVNPTNAFTGQEDPKKARLMTQKTIDVTEYYINDGKPSSAIKNQLIQNYRALADSLGMTEEDFIQFARKIPDDSLAQMISYNEQSESSRPALVDAPFFKTLQPLANQTSKTKLNDIIKIIFTQISKVTGKTNSTTGTTLEKKIVPNLKAVRSDQVIAGPNGGTSALSQATAPRTGSTVLSKQITRGLPRVPSGTGTSYPVRDPNGINTSEDNERYKVNPYNPYSKSDTSGLEAPGGEIVHNGTRPSPYAIVGVPIVAAVTTPVIRPAVLRTPPAAQSSSSALQGNTALTGAGTPRAGVAGSPGVNPGPT

Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Recombinant, E. coli

≥90% (SDS-PAGE)

Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.