375850
Grade
PurifiedMolecular Weight
29.6EU Commodity Code
30021019Shipping Temp
Blue IceStorage Temp
-20°CVTCN1, Recombinant, Human, aa26-258, His-Tag (V-set Domain-containing T-Cell Activation Inhibitor 1, B7H4)
B7 homolog 4, B7-H4, B7h.5, Immune costimulatory protein, B7-H4 Protein, B7S1, T-cell costimulatory molecule B7x
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
Source
Partial recombinant protein corresponding to aa26-258 from human VTCN1, fused to 6xHis-Tag at N-terminal, expressed in E. coli.
Amino Acid Sequence
IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Form
Supplied as a liquid in Tris, 50% glycerol.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. Sica G.L., Choi I.-H., Zhu G., Tamada K., Wang S.-D., Tamura H., Chapoval A.I., Flies D.B., Bajorath J., Chen L.Immunity 18:849-861(2003).USBio References
No references available