Technical Data

544507
Grade
Highly Purified
Applications
WB
Molecular Weight
39.7
EU Commodity Code
30021019
Shipping Temp
Blue Ice
Storage Temp
-20°C
Fibroblast Growth Factor Receptor 3 (FGFR3c), Recombinant, Human, aa23-375, His-Tag
Fibroblast Growth Factor Receptor 3 (FGFR3), FGFR3 alpha (IIIc)

It is a single-pass transmembrane protein composed of three extracellular Ig-like domains, a transmembrane region, and a tyrosine kinase domain (1, 2). Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis (3, 4, 5, 6). Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signalling cascades (6). Activation of PLCG1 leads to the production of the cellular signalling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signalling pathway, as well as of the AKT1 signalling pathway (7, 8, 9). Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signalling (10, 11). Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signalling.

FGFR3c is an alternatively spliced isoform representing epithelial variant of FGFR3.
Recombinant protein corresponding to aa23-375 from human Fibroblast Growth Factor Receptor 3 (FGFR3c), fused to 10X His-Tag at C-terminal, expressed in HEK293 cells.
Molecular Weight
~39.7kD (predicted)
AA Sequence
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGGSGHHHHHHHHHH
Applications
Suitable for use in Western Blot, Immunoassays and Functional Studies. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, HEK293 cells
Concentration
As Reported
Form
Supplied as a liquid in PBS, 20% glycerol.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.

References
1. Jaye et al. (1992) Biochim. Biophys. Acta, 185-199|2. Johnson and Williams. (1993) Adv. Cancer Res., 1-41|3. Terada et al. (2001) Mol. Cell Biol. Res. Commun., 365-373|4. Ornitz et al. (1996) J. Biol. Chem., 15292-15297|5. Agazie et al. (2003) Oncogene, 6909-6918|6. Zhang et al. (2006) J. Biol. Chem., 15694-15700|7. Ben-Zvi et al. (2006) J. Cell Sci., 380-387|8. Harada et al. (2007) Bone, 273-281|9. Citores et al. (2007) J. Cell. Physiol., 148-156|10.Krejci et al. (2008) PLoS ONE, E3961|11.Salazar et al. (2009) Hum. Mol. Genet., 1951-1961
USBio References
No references available
United States Biological | 4 Technology Way | Salem, MA 01970
Phone 800-520-3011 | Fax 978-594-8052 | Website www.usbio.net