Technical Data

584034
Grade
Purified
Molecular Weight
45.6
Shipping Temp
Blue Ice
Storage Temp
-20°C
Cold-inducible RNA-binding Protein, Recombinant, Human, aa1-172, GST-Tag
A18 hnRNP; A18HNRNP; cirbp; CIRBP_HUMAN; CIRP; Cold inducible RNA binding protein; Cold-inducible RNA-binding protein; Glycine rich RNA binding protein; Glycine-rich RNA-binding protein CIRP; testicular tissue protein Li 39

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed.

Full length recombinant protein corresponding to aa1-172 from human Cold-inducible RNA-binding protein, fused to GST-Tag at N-terminal, expressed in E.coli. Swiss/Uniprot Accession: Q14011
Molecular Weight
~45.6kD
Amino Acid Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Purity
≥90% (SDS-PAGE)
Concentration
As Reported
Form
Supplied as a liquid in Tris, pH 8.0, 50% glycerol
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.

References
No references available
USBio References
No references available
United States Biological | 4 Technology Way | Salem, MA 01970
Phone 800-520-3011 | Fax 978-594-8052 | Website www.usbio.net