Replication Factor C Subunit 1, Recombinant, Human, aa402-492, His-Tag, Myc-Tag
A1 140kD subunit; A1; A1 P145 Activator 1 large subunit; Activator 1 140kD subunit; Activator 1 large subunit; Activator 1 subunit 1; DNA binding Protein PO GA; DNA-binding protein PO-GA; MHC binding factor beta; MHCBFB; PO GA; RECC1; Replication factor C (activator 1) 1, 145kD; Replication factor C 140kD subunit; Replication factor C; Replication factor C large subunit; Replication factor C subunit 1; Replication factor C1; RF-C 140kD subunit; RFC; RFC1; RFC1_HUMAN; RFC140; RFC140 Replication Factor C 140kD subunit
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.
Source
Recombinant protein corresponding to aa402-492 from human Replication factor C subunit 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
Amino Acid Sequence
GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
