Basic Leucine Zipper and W2 Domain-containing Protein 2, Active, Recombinant, Human, GST-Tag, aa1-419 (BZW2)
May be involved in neuronal differentiation.
Recombinant protein corresponding to aa1-419 from Basic leucine zipper and W2 domain-containing protein 2, fused to GST-Tag at N-terminal, exoressed in E.coli.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22ug/ml.
Amino Acid Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder from Tris-HCl, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
