Insulin-like Growth Factor II, Active, Recombinant, Human, aa25-91 (IGF2)
Insulin-Like Growth Factor II, IGF-II, Somatomedin-A, IGF2, PP1446
The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable).
Recombinant protein corresponding to aa25-91 from human Insulin-like growth factor II, expressed in E.coli.
Biological Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 20ng/ml.
Amino Acid Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Source
Recombinant, E. coli
Concentration
~0.1-1mg/ml (after reconstitution)
Form
Supplied as a lyophilized powder from 5mM HAC, pH 3.0. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
