You are here:Home
»
Antibodies
»
Abs to G Proteins
»
Anti -Arrestin 1, beta (ARRB1, Beta-arrestin-1, ARR1, Arrestin beta-1)
Anti -Arrestin 1, beta (ARRB1, Beta-arrestin-1, ARR1, Arrestin beta-1)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Rabbit |
Affinity Purified |
B |
|
| Beta-arrestin 1 is a 418aa containing signaling neurotransmitter that belongs to the arrestin family with an arrestin N-terminal and an arrestin C-terminal domain. A regulator of beta-adrenergic receptor function, Beta-arrestin 1 seems to bind to phosphorylated beta-adrenergic receptors, thereby causing a significant impairment of their capacity to activate G(S) proteins. It is also reported to act as an activator of the lymphoid enhancer factor (LEF) transcription factor. Beta-arrestin 1 plays a crucial role in ubiquitination and down-regulation of the insulin-like growth factor-1 receptor by acting as an adaptor for the MDM2 E3 ligase. Purified beta-arrestin inhibits the signaling function of BARK-phosphorylated beta-adrenergic receptors by more than 75%, but not that of rhodopsin, and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most tissues. | | | Catalog # | 123572 | | Applications | Suitable for use in Western Blot. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Rabbit | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Full length human ARRB1, aa1-418 (NP_004032.2). | | Specificity | Recognizes human ARRB1. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
