You are here:Home
»
Antibodies
»
Abs to Transcription Factors, Homeobox (HOX)
»
Anti -CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1)
Anti -CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B IF |
|
| The caudal type homeo box transcription factor 1 (CDX1) and CDX2 are candidates for directing intestinal development, differentiation, and maintenance of the intestinal phenotype. CDX1 is a 265aa protein with 85% identity to mouse Cdx1 (98% identity, including conservative aa changes). CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. Decrease in human CDX1 and/or CDX2 expression is associated with colorectal tumorigenesis. On the other hand, increased CDX1 expression is associated with chronic atrophic gastritis. | | | Catalog # | 124817 | | Applications | Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. | | Recommended Dilution | Immunofluorescence: 10ug/ml | | Optimal dilutions to be determined by the researcher. | | AA Sequence | GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 2D8 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Partial recombinant corresponding to aa126-215 from human CDX1 (NP_001795) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human CDX1. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
