Flt3L exists in both a membrane-bound and proteolytically cleaved soluble isoform, both of which are biologically active, and initiates cell proliferation/ differentiation signalling in co-operation with other colony stimulating factors (CSFs) and interleukins, by binding to and activating the tyrosine kinase receptor Flt3 (FLT3R), expressed highly by hematopoietic progenitor cells and stem cells.
Applications
Suitable for use in Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human FLT3LG, aa1-235 (NP_001450.2).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FLT3LG.