You are here:Home
»
Antibodies
»
Abs to Tubulin
»
Anti -Tubulin beta-2A Chain (Tubulin beta Class IIa, TUBB2A, TUBB2, TUBB, dJ40E16.7)
Anti -Tubulin beta-2A Chain (Tubulin beta Class IIa, TUBB2A, TUBB2, TUBB, dJ40E16.7)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B IH |
|
| Tubulin is a heterodimer (110kD) composed of identical molecular weight alpha/beta subunits. Beta-Tubulin is present in all nucleated eukaryotic cells. The antigen recognized by this antibody is present in most all species of living organisms. | | | Catalog # | 134906 | | Applications | Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. | | Recommended Dilution | Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml | | Optimal dilutions to be determined by the researcher. | | AA Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 2B2 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Full-length recombinant corresponding to aa1-445 from human TUBB2A (AAH01194) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human TUBB2A. Species Crossreactivity: mouse and rat. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. | | Alternate names | TUBB 2, Tubulin beta 2A, TUBB 2A, TUBB 2C, TUBB2C |
External Links
|
