You are here:Home
»
Molecular Biology
»
MB-Peptides
»
Brain Natriuretic Peptide, Recombinant, Human (BNP)
Brain Natriuretic Peptide, Recombinant, Human (BNP)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Brain Natriuretic Protein is a protein secreted by the brain and the heart atria, stored mainly in cardiac ventricular myocardium. It can cause Natriuresis; Diuresis; Vasodilation; and inhibits secretion of Renin and Aldosterone. It improves heart function. BNP contains 32 Amino acids. | | | Catalog # | B2702-30 | | Amino acid sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstitute to nominal volume by adding sterile, dH2O, 0.1% HSA or BSA. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Source | E. coli. | | Purity | 98% by RP-HPLC, SDS-PAGE. | | Form | Supplied as a lyophilized powder in PBS. Reconstitute with sterile, dH2O, 0.1% HSA or BSA to a concentration of 0.1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
