Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Neurotrophins » Anti -Cardiotrophin 1 (CT-1)

Anti -Cardiotrophin 1 (CT-1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
Cardiotrophin-1 (CT-1) is a 201-amino-acid member of the interleukin-6 superfamily. It was identified by its ability to induce hypertrophic response in cardiac myocytes. CT-1 activates gp130 dependent signaling and stimulates the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway to transduce hypertrophic and cytoprotective signals in cardiac myocytes. It has also a neurotrophic function. The deficiency causes increased motoneuron cell death in spinal cord and brainstem nuclei of mice during a period between embryonic day 14 and the first postnatal week. Moreover, CT-1 is a hepatocyte survival factor that efficiently reduces hepatocellular damage in animal models of acute liver injury.
Catalog #C1385-10
CT-1 expression is augmented after hypoxic stimulation. It can protect cardiac cells when added either prior to simulated ischaemia or at the time of reoxygenation following simulated ischaemia. It can also induce expression of the protective heat shock proteins (hsps) in cardiac cells, increased ventricular expression of ANP, brain natriuretic peptide (BNP) and angiotensinogen mRNA. CT-1 levels were significantly elevated in patients with heart failure, dilatative cardiomyopathy, moderate/severe mitral regurgitation, stable and unstable angina and after acute myocardial infarction.
Sequence
MRGSHHHHHHGS]SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
ApplicationsSuitable for use in ELISA, Western blotting.
TiterDefined by indirect ELISA is >1:100,000 for antibody concentration 1mg/ml, 25ng of antigen are coated per well, and is then defined at a point of maximal decrease of the titration curve.
ReconstitutionAdd 0.1ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Quality Control TestIndirect ELISA-to determine titer of the antibody.
Storage and Stability May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%). Freeze at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Numbern/a
Clone TypeMonoclonal
IsotypeIgG1
Clone No5i143
HostMouse
SourceHuman
Concentration1mg/ml
FormSterile filtered and lyophilized from 2mg/ml in 0.05 M PBS, 0.1M sodium chloride, pH 7.2.
PurityAffinity chromatography on a column with immobilized protein G.
ImmunogenHuman Cardiotrophin, created as a recombinant protein with N-terminal fusion of His-Tag, is a 22.5kD protein containing 200 amino acid residues of the human cardiotrophin and 12 additional amino acid residues from E. coli.
SpecificityThe amino acid sequence of the recombinant human cardiotrophin is 100% homologous to the amino acid sequence of the human cardiotrophin.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links