You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-MIF
»
Migration Inhibitory Factor, Recombinant, Human (Macrophage MIF, Glycosylation-Inhibiting Factor, GIF, GLIF, MMIF)
Migration Inhibitory Factor, Recombinant, Human (Macrophage MIF, Glycosylation-Inhibiting
Factor, GIF, GLIF, MMIF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration. | | | Catalog # | M3895-07V | | MIF human Recombinant was cloned into an E .coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5kD. | | Amino acid sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM | | AFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVY | | INYYDMNAANVGWNNSTFA. | | Biological Activity | Human PBMCs were cultured with 0-1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Source | E. coli | | Purity | 97% (HPLC, SDS-PAGE) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder from 10mM PBS, pH 7.5. Reconstitute sterile ddH2O at a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
