USBio Logo

T5010-11 Thioredoxin, Recombinant, Human CAS:

Specifications
References
Grade
Purified
Molecular Weight
11.9
EU Commodity Code
30021019
Shipping Temp
RT
Storage Temp
-20°C

Thioredoxins are small disulphide -containing redox proteins (within the conserved Cys-Gly-Pro-Cys active site) that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. Thioredoxins are involved in the first unique step in DNA synthesis. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase.

Recombinant human Thioredoxin is a single, non-glycosylated, polypeptide chain of 96aa having a molecular mass of 11.9kD. The pI is 4.67.
Amino Acid Sequence
HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA
Biological Activity
The specific activity was found to be ~3IU/mg. Activity was assayed by measuring the change in absorbance at 650nm at 25°C using 0.13uM bovine insulin containing 0.33mM DTT (pH 6.5).
Storage and Stability
Lyophilized powder may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O. Can be further diluted to other aqueous solutions.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
References
1. Kondo, N., et al., J. Immunol. 172(1): 442-448 (2004). 2. Liu, F., et al., Gene 315: 71-78 (2003). 3. Watson, W.H., et al., J. Biol. Chem. 278(35): 33,408-33,415 (2003). 4. Jimenez, A. & Miranda-Vizuete, A., Protein Expr. Purif. 27(2): 319-324 (2003). 5. Sadek, C.M., et al., J. Biol. Chem. 278(15): 13,133-13,142 (2003). 6. Mitsui, A., et al., Antioxid. Redox. Signal 4(4): 693-696 (2002).
USBio References
No references available
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved