Technical Data
122949
ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7)
Description:
ACVR1C, a serine/threonine protein kinase, is a type I receptor for the TGFB family of signaling molecules. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors. ACVR1C is a receptor for activin AB, activin B and NODAL. This protein plays a role in cell differentiation, growth arrest and apoptosis.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k2E3Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa23-112 from human ACVR1C (AAH22530) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human ACVR1C.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.