Technical Data
123345
ANP32A (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member A, Acidic Nuclear Phosphoprotein pp32, Leucine-rich Acidic Nuclear Protein, LANP, Mapmodulin, Potent Heat-stable Protein Phosphatase 2A Inhibitor I1PP2A, Putative HLA-DR-associated Protei
Description:
Apoptosis is related to many diseases and development. Caspase-9 plays a central role in cell death induced by a variety of apoptosis activators. Cytochrome c, after released from mitochondria, binds to Apaf-1, which forms an apoptosome that in turn binds to and activate procaspase-9. Activated caspase-9 cleaves and activates the effector caspases (caspase-3, -6 and -7), which are responsible for the proteolytic cleavage of many key proteins in apoptosis. The tumor suppressor putative HLA-DR-associated proteins (PHAPs) were recently identified as important regulators of mitochondrion apoptosis. PHAP appears to facilitate apoptosome-medicated caspase-9 activation and to stimulate the mitochondrial apoptotic pathway. PHAP was also shown to oppose both Ras- and Myc-medicated cell transformation.

Applications:
Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k2G11-4A5Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Full length recombinant corresponding to aa1-249 from ANP32A (AAH07200) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human ANP32A.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1. Foamy viral nuclear RNA-export is distinct from other retroviruses. Bodem J, Schied T, Gabriel R, Rammling M, Rethwilm A.J Virol. 2010 Dec 15. [Epub ahead of print] 2. Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action. Cheng PC, Chang HK, Chen SH.Mol Cell Proteomics. 2009 Oct 5. [Epub ahead of print]