Technical Data
123867
BCAR3 (Breast Cancer Anti-estrogen Resistance Protein 3, Novel SH2-containing Protein 2, SH2 Domain-containing Protein 3B, NSP2, SH2D3B, UNQ271/PRO308)
Description:
In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and the treatment of advanced metastatic disease. Although the drug induces remission in most patients with estrogen receptor-positive disease, all patients eventually develop resistance. van Agthoven et al. (1998) applied an insertional mutagenesis strategy to a breast cancer cell line. Infected cells were subjected to tamoxifen selection, and the resistant clones were screened for a common integration site linked with antiestrogen resistance. By screening a human testis cDNA library with the integration site-specific probe, they obtained a cDNA encoding BCAR3 (breast cancer antiestrogen resistance 3). The deduced 825aa BCAR3 protein contains a putative Src homology 2 (SH2) domain and sequences homologous to yeast CDC48. Northern blot analysis detected abundant expression of a 3.4kb BCAR3 transcript in heart, placenta, skeletal muscle, spleen, prostate, testis, ovary, small intestine, colon, fetal kidney, and several cancer cell lines, but not in nonmalignant breast tissue; a 6kb BCAR3 transcript was also detected in skeletal muscle and heart.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k3G4Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Partial recombinant corresponding to aa266-373 from BCAR3 (AAH39895)with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human BCAR3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.