Technical Data
125181
COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621)
Description:
Collagen XXIII a1 (COL23A1) is an epithelial cell type 2 transmembrane glycoprotein with multiple collagen-like domains in its extracellular region. Intracellular furin-mediated cleavage of the molecule generates a 58kD shed fragment that forms disulfide-linked trimers. An alternately spliced isoform consists of nearly 300aa of the membrane proximal extracellular domain (ECD), flanked by substituted sequences. COL23A1 is upregulated in many transformed cell lines and serves as an indicator for tumor aggressiveness in prostate cancer. Within the ECD, human COL23A1 shares 89% aa sequence identity with mouse and rat COL23A1.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k2E10Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa338-411 from human COL23A1 (NP_775736) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human COL23A1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.