Technical Data
142904
Interleukin 17AF Heterodimer, Recombinant, Mouse (IL-17AF Heterodimer)
5ug
25ug
100ug
Molecular Biology Storage: -20CShipping: Blue Ice
Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL- 17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL- 17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells.

Source:
Recombinant protein corresponding to 271aa rat IL-17AF expressed in E.coli.

Molecular Weight:
~30.7kD

Endotoxin:
1EU/ug (LAL)

Biological Activity:
The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75- 325ng/ml.

AA Sequence:
MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVN AEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA IL-17F subunit: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQG QEDSTMNSVAIQQEILVLRREP

Storage and Stability:
Lyophilized powder may be stored at -20C. Stable for 12 months at -20C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
~30.7kD
Source: E.coli
Purity: ~98% (HPLC, Reducing and non-reducing SDS-PAGE)
Form: Supplied as a lyophilized powder. No additives. Reconstitute with sterile dH2O.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.