Technical Data
G8975-21
GRO beta, Recombinant, Rat
5ug
25ug
Molecular Biology Storage: -20°CShipping: RT
Rat GRO-ß (Rat MIP2) promotes neutrophil chemotaxis and degranulation. Rat GROß is a 7.9kD protein containing 73 amino acid residues.

Source: E. coli

Form: Lyophilized protein with no additives.

Stability: The lyophilized protein, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted rat GRO-ß should be stored in working aliquots at -20°C.

Purity: Greater than 98% by SDS-PAGE and HPLC analyses.

Endotoxin: 0.1ng/ug

Reconstitution: Lyophilized rat GRO-ß is soluble in water and most aqueous buffers. The lyophilized protein should be reconstituted in water to a concentration of 100 ng/ul. This solution can be diluted into water or other buffered solutions or stored at -20°C for future use.

Biological Activity: The maximal chemotactic activity of rat GRO-ß on rat neutrophils as assayed in a modified Boyden chamber was achieved at 50ng/ml.

Responding Cells (partial list): Neutrophils

Concentration Range for most in vitro applications: 10-100ng/ml

AA Sequence: VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN

Country of Origin: USA


Molecular Weight:
7.9kD
Source: Rat

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.