Technical Data
M1202-73N
Macrophage Inflammatory Protein 5, Recombinant, Human (MIP5)
5ug
25ug
25ug
|
Technical Data |
|
M1202-73N |
Macrophage Inflammatory Protein 5, Recombinant, Human (MIP5) |
5ug 25ug |
| Growth Factors, Cytokines | Storage: -70°CShipping: Dry Ice |
|
CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid (aa) protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1y, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is expressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml. AA Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSK PGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. Molecular Weight: 10.1 kD |
Source: Escherichia coli Purity: ~97% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||