ACACA (Acetyl-CoA carboxylase alpha/1; also ACC1and biotin carboxylase) is a 260-265kD cytoplasmic, phosphorylated biotinylenzyme.It is widely expressed, and found to be concentrated in hepatocytes, adipocytes and lactating mammary epithelium. It is one of two gene products (ACACB/beta being the other) that catalyze the formation of malonylCoA from acetylCoA. The formation of malonylCoA by ACACA is a rate limiting step in fatty acid synthesis; malonylCoA formed by ACACB acts as a regulator of CPT1 during fatty aciid oxidation. Human ACACA is 2346aa in length. It contains an N-terminal acetylated Met, one ATPGrasp-domain (aa275-466) with an embedded biotin carboxylation domain (aa117-618), a biotinyl binding region (aa752-818), and a carboxyl transferase domain (aa1698-2194). There are at least 17 utilized phosphorylation sites, and two acetylated Lys. ACACA exists as either a dimer or higher order oligomer. Multiple splice variants exist. One possesses an alternative start site at Met79, a second utilizes an alternative start site 37aa upstream of the standard site, and a third (called PIII) shows a 17aa substitution for aa1-75. Over aa1185-1352, human ACACA shares 95% aa identity with mouse ACACA, and 97% aa identity with both ovine and bovine ACAC-A.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1-99 from human ACACA (NP_942131) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human ACACA.