A3 Adenosine Receptor is a widely expressed receptor that mediates the multiple functions of adenosine. For example, this receptor is believed to mediate the protective effect of adenosine released during cardiac ischemia. In lungs, the receptor mediates inhibition of eosinophil chemotaxis and may be useful in the treatment of eosinophil-dependent diseases such as asthma and rhinitis. Adenosine A3 Receptor has been reported mostly in brain, lung, liver, heart, kidney, and testis. ESTs have been isolated from heart/melanocyte/uterus, kidney, pituitary, and placenta libraries.

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa121-225 from human ADORA3 (AAH29831) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human ADORA3.