Transcriptional responses to many environmental and developmental stimuli are mediated by the basic helix-loop-helix (bHLH)-PAS family of proteins, which form homodimers that bind regulatory DNA sequences. ARNT/HIF-1 beta regulates the expression of different sets of genes in response to distinct environmental challenges. ARNT forms a complex with arylhydrocarbon receptor (AHR) to activate expression of genes encoding P450. Once AHR binds it ligand, it associates with ARNT for transport into the nucleus. ARNT also dimerizes with HIF-1alpha, -2 alpha or -3 alpha in response to low oxygen concentration to induce the expression of hypoxia-regulated genes encoding vascular endothelial growth and other genes. The expression of ARNT/HIF-1beta remains fairly constant and the protein is found in the nucleus and the cytoplasm.

Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human ARNT.