Cacna2d2 is an alpha subunit 2/delta regulatory subunit of the voltage-gated calcium channel. The human Cacna2d2 corresponds to the mouse mutant ducky phenotype, which is a model for absence epilepsy, characterized by seizures and ataxia. CACNA2D2 overexpression has been implicated in the apoptosis of NSCLC cells by changing the intracellular calcium concentration and disrupting the mitochondrial membrane.

Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.

Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.

PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa65-162 from CACNA2D2 (NP_006021) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human CACNA2D2.