CD1b is a 43kD member of the immunoglobulin superfamily also known as R1. It is a type I membrane glycoprotein with structural similarities to MHC class I and is non-covalently associated with B2-microglobulin. In humans, CD1 family consists of group I proteins (CD1a, CD1b, CD1c), group II (CD1d), and group III (CD1e). CD1b plays a role in non-peptide glycolipid antigen presentation to CD1-restricted T cells. It is expressed on cortical double positive and single positive thymocytes, Langerhans cells, and dendritic cells. In addition to antigen presentation, CD1b has been implicated in thymic T cell development.

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa19-110 from human CD1B (NP_001755.1) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CD1B.