CD26 is a multifunctional protein that exists as a membrane bound form and a soluble form. CD26 has three major functions including adenosine deaminase (ADA) binding, peptidase activity and extracellular matrix binding, all of which can influence T-cell proliferation and chemotaxis. It has also been shown to be involved in apoptosis.
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa352-451 from human DPP4 (BC065265; AAH65265) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DPP4.