Three major isoforms of Cdk11 identified are the full length gene product Cdk11p110 and the shorter polypeptides Cdk11p58 and Cdk11p46. Cdk11p110 is a component of RNA polymerase II containing complexes involved in transcriptional regulation, and is implicated in pre-mRNA splicing through interaction with the splicing factor RNPS1 (RNA-binding protein with serine-rich domain 1). Cdk11p58 has been linked with mitosis, cell cycle arrest and apoptosis, and recently implicated as a negative regulator of the androgen receptor (AR) as part of a cyclin D3/ Cdk11p58 complex. Cdk11p46 arises from the cleavage of Cdk11p110 and Cdk11p58 by caspases following the induction of apoptosis, and is linked with apoptotic progression.

Suitable for use in Immunofluorescence and FLISA. Other applications not tested.

Sandwich FLISA: The detection limit is ~0.03ng/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.

GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa681-780 from human CDC2L2 (NP_277073) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CDC2L2.