Cyclin-dependent kinase 4 (Cdk4) is a 34kD catalytic subunit of the protein kinase complex and belongs to the Ser/Thr protein kinase family. Cdk4 forms a complex with D-type cyclins and may regulate cell growth during G1 phase of the cell cycle. Cdk4 also associates with Cdk inhibitor p16 that down-regulates Cdk4 activity. Mutations in Cdk4 are associated with tumorigenesis of a variety of cancers.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length human CDK4, aa1-303 (NP_000066.1).

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CDK4.