The CILP-1 (cartilage intermediate-layer protein 1) gene product is a 138kD monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90kD N-terminal CILP-1, and a 62kD C-terminal NTPPHase-homolog. The N-terminus is suggested to serve as both a matrix structural protein, and an IGF-I/TGF-beta1 suppressor sequestration molecule. Human CILP-1 spans aa22-720 of the CILP-1 precursor. It contains one TSP-1 domain (aa149-201) and a C2-type Ig-like region (aa309-395). Over aa1-720 of the CILP-1 precursor, human CILP-1 shares 89% aa identity with mouse CILP-1, and 42% aa identity with human CILP-2.

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML*

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa129-227 from CILP (NP_003604) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CILP.