Creatine Kinase (CK) is a dimeric enzyme composed of either M- or B-type subunits. The resulting isoenzymes are expressed at varying levels in different tissues. CK-BB, a cytoplasmic predominantly found in brain tissues, participates in energy homeostasis, reversibly catalyzing the transfer of a phosphate group between ATP and target proteins such as a creatine phosphate. CK-BB exists in normally neglible amounts in the serum of adults, overexpression of CK-BB is associated with cancers of the breast, ovary, prostate, colon, and in small-cell lung cancer. Global assessment of changes in serum levels of CK-BB, CK-MB and CK-MM, are used as a marker for myocardial infarction.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-381 from human CKB (AAH01190) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CKB.
TDS
NCBI
UniProt
Tech Support
Customer Service
