DRP-3 belongs to the hydantoinase/dihydropyrimidase subfamily. It is required for signalling by class 3 semaphorins and remodelling of the cytoskeleton. It also plays a role in axon guidance, neuronal growth cone collapse and cell migration. It exists as a homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL4 or DPYSL5. The unprocessed precursor is 570 amino acids long and has an estimated molecular weight of 61.9kD. It is mainly expressed in heart and skeletal muscle, but is also strongly expressed in fetal brain and spinal cord. It localizes to the cytoplasm and growth cone. This protein interacts with synaptic vesicle protein 2 and SH3A domain of intersectin.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
GNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKR
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa457-555 from human DPYSL3 (NP_001378) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DPYSL3.