Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells.

Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.

Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.

MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa1-111 from human CREB3L4 (NP_570968) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human CREB3L4.