DNA damage binding protein (DDB) is a heterodimer that functions in DNA repair, and is associated with the DNA repair deficiency disease xeroderma pigmentosum (XP). The damaged DNA binding function of DDB requires both DDB1 (p125, 127kD) and DDB2 (p48, 48kD) subunits. When the subunits of DDB are expressed individually, p48 localized in the nucleus and p125 localized in the cytoplasm. Co-expression of p125 with p48 resulted in an increased accumulation of p125 in the nucleus, indicating that p48 plays a critical role in the nuclear localization of p125.

Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Sandwich FLISA (Recombinant protein): The detection limit is ~0.3ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DDB1 on human adrenal gland. Optimal dilutions to be determined by the researcher.

SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1044-1140 from human DDB1 (NP_001914) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human DDB1.