Apoptosis plays an important role in many cellular processes. Dio-1 (Death Inducer-O bliterator-1), a putative transcription factor, has been indicated to function in the onset of apoptosis. Dio-1 expression is upregulated when an apoptosis is detected. It translocates to the nucleus, and activates apoptosis during limb development. Dio-1 expression can be suppressed by caspase inhibitors and Bcl-2 expression.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa321-420 from human DIDO1 (AAH14489) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human DIDO1.