A subset of the tumor necrosis factor (TNF) receptor family contain a conserved intracellular motif, the death domain. A member of this family, TRICK2, the TRAIL (TNF-related apoptosis-inducing ligand) receptor inducer of cell killing 2) is expressed in a number of cell types, and to particularly high levels in lymphocytes and spleen. TRICK2, like DR4, is a receptor for TRAIL:APO-2L [2,3] and could inhibit TRAIL-induced killing.

Suitable for use in FLISA, Immunoprecipitation and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa71-170 from TNFRSF10B (AAH01281) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human TNFRSF10B.