GABA(B) receptor 1, a GABA(B) Receptor, forms a heterodimer with GABA(B) receptor 2 to mediate the effects of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the central nervous system. Activation of this receptor leads to fast synaptic inhibition. Reduced GABA(B) receptor 1a-b expression is implicated in the pathophysiology of temporal-lobe epilepsy. In primates, GABA(B) receptors are widely distributed and are located to subserve both pre- and postsynaptic roles in controlling synaptic transmission in the primate basal ganglia. Five alternatively spliced protein isoforms of GABA(B) receptor 1 have been identified. GABA(B) receptor 1 is widely expressed, with highest levels reported in brain, and lower levels in gastrointestinal tract, kidney, and uterus. ESTs have been isolated from a wide variety of tissues, including adrenal, brain, breast, colon, embryo, eye, ganglion, head/neck, heart, heart/melanocyte/uterus, liver/spleen, lung, nerve, placenta, prostate, stomach, testis, and tonsil libraries, among others.

Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa52-151 from human GABBR1 wiith GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human GABBR1.