Geranylgeranyl diphosphate (GGPP) synthase (GGPS) catalyzes the synthesis of GGPP, a molecule responsible for the C20-prenylation of protein and for the regulation of a nuclear hormone receptor. The deduced 300aa human protein contains 5 conserved domains consistent with prenyltransferases. Recombinant GGPS shows enzymatic properties associated with the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. Mouse GGPS is regulated in several tissues in obesity and is induced during adipocyte differentiation. GGPS is increased 5- to 20-fold in skeletal muscle, liver, and fat of ob/ob mice. Western blot analysis detects a 2-fold overexpression of protein in muscle and fat but not in liver. Differentiation of mouse fibroblasts into adipocytes induces GGPS expression more than 20-fold.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa201-300 from GGPS1 (NP_004828) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human GGPS1.