The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.

Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested.

Optimal dilutions to be determined by the researcher.

HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa473-568 from human GOLPH4 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human GOLPH4