MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Growth factor receptor-bound protein 10 (Grb10) belongs to a small family of structurally related multi-domain adaptor proteins, which are known to be involved with a diverse array of functions, including cellular growth, metabolism, apoptosis, and cell migration. Grb10 is widely, but not uniformly, expressed in mammalian tissues, and there are various known isoforms of Grb10. It is shown to bind to and positively or negatively mediate signals from a number of activated receptor tyrosine kinases, including the insulin (INSR) and the insulin-like growth factor (IGF1R and IGF2R) receptors, in addition to a variety of growth factor receptors and intracellular molecules, in a context-dependent manner. In one study, mTORC1-mediated Grb10 phosphorylation is demonstrated to lead to feedback inhibition of the phosphatidylinositol-3-kinase (PI3K) and the extracellular signal-regulated, mitogen-activated protein kinase (ERK-MAPK) pathways in HEK 293T cells, in vivo. However, many aspects of the Grb10 adapter function remain unclear. Further research is still required to elucidate and validate the interactions and effects of GRB10 with various cellular targets.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa61-150 from human GRB10 (AAH24285) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GRB10.