HIPK2, a member of the KIPK subfamily of Ser/Thr protein kinases, phosphorylates homeodomain transcription factors. It may play a role as a corepressor for homeodomain transcription factors. This nuclear protein has been shown to interact with TRADD. It is highly expressed in neuronal tissues, heart and kidney, and weakly expressed in a ubiquitous way. HIPK2 is a target for sumoylation, and when conjugated it is directed to nuclear speckles

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT*

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa961-1065 from human HIPK2 (AAG41236) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human HIPK2. Species Crossreactivity: rat.