This monoclonal antibody recognizes human IL-23, a heterodimeric cytokine composed of the p40 subunit shared with IL-12 and a specific p19 subunit. This antibody recognizes heterodimeric IL-23, but does not react with the p40 subunit alone or recombinant IL-12(p70) when used as a capture antibody in FLISA. IL-23 is secreted by activated dendritic cells and macrophages and has been shown to enhance IFN-y secretion by memory (CD45RO) T cells in an IL-2 dependent manner. IL-23 may also induce unique Th subset (designated ThIL-17) that secretes the cytokines IL-17, IL-6, TNF and low levels of IFN-y. IL-23 has been shown to promote immunity to mycobacteria and has been shown to be upregulated in response to some viral infections and in psoriatic lesions. IL-23 binds to the IL-23 receptor comprised of a B1 subunit shared with the IL-12 receptor and IL-23-specific subunit.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length protein corresponding to aa1-189 of human IL23A.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human IL23A.