The murine scavenger receptor class A (SRA), type I and II is also known as CD204. CD204 is expressed by tissue macrophages and functions both as an endocytic receptor for lipoproteins and as an adhesion receptor for macrophages binding to ligand rich tissues e.g. atherosclerotic lesions. Inhibits the uptake of acetylated low-density lipoproteins and also inhibits divalent cation independent adhesion.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa121-220 from human MSR1 (NP_619729) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human MSR1.