MCM3AP is a 1980aa protein belonging to the SAC3 family and contains domains for MCM3-binding and RNA-primase activities. It is a potent natural inhibitor of the initiation of DNA replication whose action is mediated by interaction with MCM3. Interaction between MCM3 and MCM3AP is essential for nuclear localization and chromatin binding of MCM3AP. It limits DNA replication to once per cell cycle. MCM3AP is an acetyltransferase that acetylates MCM3. It also plays a role in B cell proliferation, differentiation and MCM3 nuclear localization. It is expressed mostly in germinal centers (GCs) of B cells.

Suitable for use in Immunofluorescence and FLISA. Other applications not tested.

Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.

VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1-100 from MCM3AP (AAH13285) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human MCM3AP.